Sequence 1: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002138.1 | Gene: | HOXB5 / 3215 | HGNCID: | 5116 | Length: | 269 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 64/202 - (31%) |
---|---|---|---|
Similarity: | 84/202 - (41%) | Gaps: | 48/202 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 ETRSSENGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDISISDERTSL---AAYPAYDFYGHAKDY 114
Fly 115 PQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHFSAGFSA 179
Fly 180 FLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRA 244
Fly 245 KDKRIEK 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ro | NP_524521.1 | Homeobox | 196..247 | CDD:278475 | 30/50 (60%) |
HOXB5 | NP_002138.1 | PRK07003 | <67..>171 | CDD:235906 | 24/106 (23%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 77..173 | 24/108 (22%) | |||
Antp-type hexapeptide | 176..181 | 2/6 (33%) | |||
Homeobox | 198..251 | CDD:395001 | 31/52 (60%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |