DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and HOXA6

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_076919.1 Gene:HOXA6 / 3203 HGNCID:5107 Length:233 Species:Homo sapiens


Alignment Length:198 Identity:61/198 - (30%)
Similarity:83/198 - (41%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PYHSDGGSVSSPDISIS-----DERTSLAA-------YPAYDFYGHAKDYPQHPSQQHQQH--HH 127
            |:.:..|:.|.||.:.:     .:..|:.|       |.|..||.........||...:|.  ..
Human    37 PFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGD 101

  Fly   128 HHHHPPQLVHQKLSYVSPPPAIAAGGA----ANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRKE 188
            :.|..|:..::..|......|:...||    .:||.|                   ::.|.....
Human   102 YLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYP-------------------WMQRMNSCA 147

  Fly   189 G-----RQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKR 248
            |     ..||.|.|::..|||.||.|||.|.|::|.||.|:|..|.|||.||||||||||.|.|:
Human   148 GAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKK 212

  Fly   249 IEK 251
            ..|
Human   213 ENK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 31/50 (62%)
HOXA6NP_076919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..127 7/37 (19%)
Antp-type hexapeptide 136..141 2/23 (9%)
Homeobox 159..212 CDD:365835 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..233 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.