DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and HOXA5

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens


Alignment Length:255 Identity:70/255 - (27%)
Similarity:87/255 - (34%) Gaps:99/255 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ANTTILSVPQRPSSPRQFFERLYGHLETRSSENGEIDVGTHAHKPP--PCDT--------PYH-- 79
            |.:...|....|:.||      |....|          .||:.:|.  ||..        .:|  
Human    70 ARSYAASASAAPAEPR------YSQPAT----------STHSPQPDPLPCSAVAPSPGSDSHHGG 118

  Fly    80 ------SDGGSVSSPDISISD-ERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVH 137
                  |.|.|..:....||. |....|:       |..:|.|....|...|             
Human   119 KNSLSNSSGASADAGSTHISSREGVGTAS-------GAEEDAPASSEQASAQ------------- 163

  Fly   138 QKLSYVSPPPAIAAGGAANPVLPHAFP-----------AGFPSDPHFSAGFSAFLARRRRKEGRQ 191
               |..||.|         |..|..:|           .|.|                   ||  
Human   164 ---SEPSPAP---------PAQPQIYPWMRKLHISHDNIGGP-------------------EG-- 195

  Fly   192 RRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEK 251
            :|.||.::..|||.||.|||.|.|::|.||.|:|..|.|:|.||||||||||.|.|:..|
Human   196 KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 29/147 (20%)
Antp-type hexapeptide 176..181 1/4 (25%)
Homeobox 199..251 CDD:306543 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.