DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and HOXA3

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens


Alignment Length:312 Identity:81/312 - (25%)
Similarity:110/312 - (35%) Gaps:110/312 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RHKVEIGSPDGSPGIKRSDSLDPIANTTILSVPQRPSSPRQFFERLYGHLETRSSENGEIDVGTH 67
            |....:.||..:.|..::..|......|:.:.|.:|.|                  .||..:   
Human    47 RPACSLQSPSSAGGHPKAHELSEACLRTLSAPPSQPPS------------------LGEPPL--- 90

  Fly    68 AHKPPPCDTPYHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHP 132
             |.|||                         .||.||          ||.|....|        |
Human    91 -HPPPP-------------------------QAAPPA----------PQPPQPAPQ--------P 111

  Fly   133 PQLVHQKLSYVSPPPAIA------------AGGAANPVL--PHAFPAGFP-----------SDPH 172
            |    .......|||:.|            |..|.:|:|  |......||           ....
Human   112 P----APTPAAPPPPSSASPPQNASNNPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSS 172

  Fly   173 FSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKI 237
            .|:|.|....:....:...:|.||.:::.|.:.||.|||.|.|:.|.||.|:|..|.|||.||||
Human   173 SSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKI 237

  Fly   238 WFQNRRAKDKRIEKAQIDQHYRNFVVANGFMSSIMGQ--AATTMPPGGVTGG 287
            ||||||.|.|:.:|.:            |.::|..||  :.:.:|||  .||
Human   238 WFQNRRMKYKKDQKGK------------GMLTSSGGQSPSRSPVPPG--AGG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 26/140 (19%)
Antp-type hexapeptide 155..160 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 4/36 (11%)
Homeobox 195..248 CDD:395001 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 11/43 (26%)
DUF4074 378..441 CDD:404218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.