DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and pdx1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571518.2 Gene:pdx1 / 30721 ZFINID:ZDB-GENE-990415-122 Length:246 Species:Danio rerio


Alignment Length:236 Identity:67/236 - (28%)
Similarity:94/236 - (39%) Gaps:52/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 HAHKPPPC------DTPYHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQH 125
            ::..||||      .:.|.|..|:...|::      |.:.:|..     .::|....|       
Zfish    28 YSQNPPPCLYMRQAHSVYASPLGAQDQPNL------TDITSYNM-----SSRDDLAGP------- 74

  Fly   126 HHHHHHPPQLVHQKLSYVSPPPAIAAGGAANPV----------LPHAFPAGFPSDPHFSAGFSAF 180
               |.|.||.....|.        :.||..:.:          ||  ||....:..|..|....:
Zfish    75 ---HLHLPQTSQTSLQ--------SLGGYGDSLDLCGDRNRYHLP--FPWMKSTKSHTHAWKGQW 126

  Fly   181 LARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAK 245
            ......:....:|.||.::..|.|.||.||..|:||||.||.|||.||.|||..|||||||||.|
Zfish   127 TGPYMVEAEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELALTLSLTERHIKIWFQNRRMK 191

  Fly   246 DKRIEKAQ----IDQHYRNFVVANGFM-SSIMGQAATTMPP 281
            .|:.|..:    :|....:.:.:.... .|.:|.|....||
Zfish   192 WKKEEDKRRARGVDPEQDSSITSGDLKDESCVGTATLAGPP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 32/50 (64%)
pdx1NP_571518.2 Homeobox 140..193 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.