DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxc3a

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001128157.2 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio


Alignment Length:129 Identity:47/129 - (36%)
Similarity:64/129 - (49%) Gaps:18/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 HAFPAGFPS-------DPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISR 218
            || |..|.|       |..:|.|.:..      :....:|.|..|::.|.|.||.|||.:.|:.|
Zfish   128 HA-PTHFSSINAMESGDSKYSNGEAVV------RNSSSKRARVAFTSSQLLELEKEFHFSAYLCR 185

  Fly   219 SRRFELAETLRLTETQIKIWFQNRRAKDKR--IEKAQIDQHYRNFVVANGFMSSIMGQAATTMP 280
            :||.|:||.|:||:.||||||||||.|.|:  .||:.....|......|  ...|:.::.|..|
Zfish   186 NRRLEMAELLKLTDRQIKIWFQNRRMKYKKDHKEKSTAKSSYTYLGTEN--QPLIISRSTTDSP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 46/126 (37%)
Homeobox 162..214 CDD:306543 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.