DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxb8b

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571256.1 Gene:hoxb8b / 30420 ZFINID:ZDB-GENE-980526-291 Length:247 Species:Danio rerio


Alignment Length:171 Identity:58/171 - (33%)
Similarity:70/171 - (40%) Gaps:39/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YGHAKDYP-QHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIA-AGGAANPVLPHAFPAGFPSD 170
            |||..... ||.:|....:||.....|.     .||...|.|:| .|.|...:|..   .|....
Zfish    41 YGHNTGSAFQHAAQFPDFYHHGTSSFPH-----ASYQQTPCAVAYPGDATGNILGQ---DGLQKQ 97

  Fly   171 PHFSAGFSAFLA----------------------------RRRRKEGRQRRQRTTFSTEQTLRLE 207
            ..|.|..|.|..                            .|.:..|| ||.|.|:|..|||.||
Zfish    98 SFFGAPDSDFTQFGDCNLKVSGIRDDLESAEPCTAQLFPWMRPQATGR-RRGRQTYSRYQTLELE 161

  Fly   208 VEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKR 248
            .||..|.|::|.||.|::..|.|||.|:||||||||.|.|:
Zfish   162 KEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
hoxb8bNP_571256.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeobox 149..201 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..247 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.