DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxc5a

DIOPT Version :10

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571219.2 Gene:hoxc5a / 30379 ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio


Alignment Length:67 Identity:35/67 - (52%)
Similarity:45/67 - (67%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 EGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKA 252
            |...:|.||:::..|||.||.|||.|.|::|.||.|:|..|.|.|.||||||||||.|.|:..|.
Zfish   163 ESDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKL 227

  Fly   253 QI 254
            ::
Zfish   228 KV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeodomain 196..248 CDD:459649 30/51 (59%)
hoxc5aNP_571219.2 Homeodomain 167..223 CDD:459649 32/55 (58%)

Return to query results.
Submit another query.