DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxb1b

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571217.2 Gene:hoxb1b / 30374 ZFINID:ZDB-GENE-980526-290 Length:307 Species:Danio rerio


Alignment Length:267 Identity:72/267 - (26%)
Similarity:102/267 - (38%) Gaps:85/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PIANTTILSVPQRP--SSPRQFFERLYGHLETRSSENGEIDVGTHAH-------KPPPCDTPYHS 80
            |:...|..|.|...  :|..|...:.: ||        .:|:|...|       :||      ||
Zfish    47 PVGGNTFTSAPHETHGTSYAQIQSQPF-HL--------NVDMGKTGHSNFCKQTRPP------HS 96

  Fly    81 DGG------------SVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPP 133
            |.|            .:.||..|:.:...::..      |..:...|...|..|           
Zfish    97 DYGHQHVLTQADDHMRLQSPGFSVVNMGANIGT------YSESNCRPGSVSASH----------- 144

  Fly   134 QLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGFPSD--------PHFSAGFSAFLARRRRK--- 187
               :|..:|..|.|......:...|.|.:     .||        |.|.     ::..:|..   
Zfish   145 ---YQSYAYGEPEPHGYGSFSKYQVSPDS-----DSDSKTNIKQAPTFD-----WMKVKRNPPKT 196

  Fly   188 --------EGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRA 244
                    .|:|...||.|:|:|...||.|||.|:|::|:||.|:|.||.|.|||:||||||||.
Zfish   197 VKVAEYGIHGQQNIIRTNFTTKQLTELEKEFHFNKYLTRARRVEVAATLELNETQVKIWFQNRRM 261

  Fly   245 KDKRIEK 251
            |.|:.||
Zfish   262 KQKKREK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 31/50 (62%)
hoxb1bNP_571217.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..178 4/23 (17%)
Antp-type hexapeptide 183..188 1/9 (11%)
Homeobox 212..264 CDD:306543 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..307 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45946
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.