Sequence 1: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571201.3 | Gene: | hoxd9a / 30350 | ZFINID: | ZDB-GENE-990415-121 | Length: | 262 | Species: | Danio rerio |
Alignment Length: | 255 | Identity: | 69/255 - (27%) |
---|---|---|---|
Similarity: | 95/255 - (37%) | Gaps: | 57/255 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 FFERLYGHLETRSSENGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDISISDERTSLAAYPAYDFY 108
Fly 109 GH-----AKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPP---PAIAAGGAANPVLP----- 160
Fly 161 -HAFPAGFPSDPHFS---AGFSAFLARRRR-----------KEGRQ------------------- 191
Fly 192 RRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEK 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ro | NP_524521.1 | Homeobox | 196..247 | CDD:278475 | 28/50 (56%) |
hoxd9a | NP_571201.3 | Hox9_act | 1..182 | CDD:282473 | 38/180 (21%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 107..187 | 17/79 (22%) | |||
Homeobox | 198..251 | CDD:278475 | 29/52 (56%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |