DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxd9a

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571201.3 Gene:hoxd9a / 30350 ZFINID:ZDB-GENE-990415-121 Length:262 Species:Danio rerio


Alignment Length:255 Identity:69/255 - (27%)
Similarity:95/255 - (37%) Gaps:57/255 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FFERLYGHLETRSSENGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDISISDERTSLAAYPAYDFY 108
            :.:.:.|| |...........|:|.....|        .|.|.:.|.|........|.:||....
Zfish    11 YVDTIMGH-EAEDVYGARYIQGSHTAPARP--------SGVVENADFSSCSFAPKSAVFPASWSS 66

  Fly   109 GH-----AKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPP---PAIAAGGAANPVLP----- 160
            .|     |.....|| ..||.|...:.:....:....:::|..   |.....|.....||     
Zfish    67 VHQPSTAAVSGIYHP-YVHQTHLSDNRYVRSWIEPVANHISLTGFHPNSRHSGTKTESLPPKRTE 130

  Fly   161 -HAFPAGFPSDPHFS---AGFSAFLARRRR-----------KEGRQ------------------- 191
             .||....||.|.||   ...||..|...|           |:.:|                   
Zfish   131 SAAFETETPSVPEFSLNAVSESADKATEERVGSDNSSHGEPKDEKQQQQLDPSNPAANWIHARST 195

  Fly   192 RRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEK 251
            |::|..::..|||.||.||..|.|::|.||:|:|..|.|||.|:||||||||.|.|::.:
Zfish   196 RKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
hoxd9aNP_571201.3 Hox9_act 1..182 CDD:282473 38/180 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..187 17/79 (22%)
Homeobox 198..251 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.