DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxb3

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:272 Identity:68/272 - (25%)
Similarity:91/272 - (33%) Gaps:99/272 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ERTSLAAYPAYDFY----GHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSP---------- 145
            :.|:.|.:..|..|    |...|.|..|..|...|....:.......|.|...:|          
  Rat     8 DNTAAALFGGYSSYPGSNGFGYDGPPQPPFQAATHLEGDYQRSACSLQSLGNAAPHAKSKELNGS 72

  Fly   146 -------PPAIAAGGAANPVLPHAFP---------AGFPS---DPHFSAGFSAFLARR---RRKE 188
                   |..:.|...:.|  |.|.|         .|.||   .|...|..::.|.::   ..||
  Rat    73 CMRPGLAPEPLPAPPGSPP--PSAAPTSTTSNSNNGGGPSKSGPPKCGASSNSTLTKQIFPWMKE 135

  Fly   189 GRQ-------------------------------------------------RRQRTTFSTEQTL 204
            .||                                                 :|.||.:::.|.:
  Rat   136 SRQTSKLKNSSPGTAEGCGGGGGGGGGGGSSSGGGGSGGGGGDKSPPGSAASKRARTAYTSAQLV 200

  Fly   205 RLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVANGFMS 269
            .||.|||.|.|:.|.||.|:|..|.|:|.||||||||||.|.|:.:||:            |..|
  Rat   201 ELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAK------------GLAS 253

  Fly   270 SIMGQAATTMPP 281
            |..|.:....||
  Rat   254 SSGGPSPAGSPP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
Hoxb3NP_001100512.1 Homeobox 191..244 CDD:395001 29/52 (56%)
DUF4074 365..427 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.