Sequence 1: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001100512.1 | Gene: | Hoxb3 / 303488 | RGDID: | 1310780 | Length: | 429 | Species: | Rattus norvegicus |
Alignment Length: | 272 | Identity: | 68/272 - (25%) |
---|---|---|---|
Similarity: | 91/272 - (33%) | Gaps: | 99/272 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 ERTSLAAYPAYDFY----GHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSP---------- 145
Fly 146 -------PPAIAAGGAANPVLPHAFP---------AGFPS---DPHFSAGFSAFLARR---RRKE 188
Fly 189 GRQ-------------------------------------------------RRQRTTFSTEQTL 204
Fly 205 RLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVANGFMS 269
Fly 270 SIMGQAATTMPP 281 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ro | NP_524521.1 | Homeobox | 196..247 | CDD:278475 | 28/50 (56%) |
Hoxb3 | NP_001100512.1 | Homeobox | 191..244 | CDD:395001 | 29/52 (56%) |
DUF4074 | 365..427 | CDD:404218 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |