DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxb4a

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio


Alignment Length:248 Identity:73/248 - (29%)
Similarity:98/248 - (39%) Gaps:56/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPPCDTPYHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHH---H 131
            |.|||:....||.....||                 |:|...:   |.||.||:..:|...   .
Zfish    16 KFPPCEEYSQSDYLPSHSP-----------------DYYSAQR---QDPSFQHESIYHQRSGCAD 60

  Fly   132 PP----QLVHQKLSYVSPPPAIAAGGAANPVLP---HAFPAGFPSDP------HFSAGFSAFLAR 183
            ||    |...|..:.:||...:....|.:..||   |...:..||.|      ..|...|...:|
Zfish    61 PPYSSCQGPGQPAAVISPRGHVLPTTALSTPLPEPSHHCDSVTPSPPPACGQTPTSQNTSTVSSR 125

  Fly   184 R------------------RRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRL 230
            :                  ....|..:|.||.::.:|.|.||.|||.|.|::|.||.|:|.||.|
Zfish   126 KDPVVYPWMKKVHVNIVSPNYSGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLCL 190

  Fly   231 TETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVAN--GFMSSIMGQAATTMPP 281
            :|.||||||||||.|.|:..|....:...|....|  |..:....|:..:.||
Zfish   191 SERQIKIWFQNRRMKWKKDHKLPNTKIRSNSASTNSSGCPTLCSNQSRASGPP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125 27/121 (22%)
Antp-type hexapeptide 130..135 0/4 (0%)
Homeobox 154..207 CDD:278475 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.