DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxb2a

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_571191.1 Gene:hoxb2a / 30338 ZFINID:ZDB-GENE-990415-103 Length:390 Species:Danio rerio


Alignment Length:141 Identity:54/141 - (38%)
Similarity:65/141 - (46%) Gaps:18/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PSQQHQQHHHH-------HHHPPQLVHQKLSYVSPPP-AIAAGGAANPVLPHA--FPAGFPSDPH 172
            |..||||....       .|..|.:..:|.|...|.| |.||..||:|....:  ..||..|...
Zfish    83 PPTQHQQGPAPLSGGAPLAHEFPWMKEKKSSKKCPKPGATAAAAAASPSQASSGYTTAGLESPTE 147

  Fly   173 FSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKI 237
            ...|..        .....||.||.::..|.|.||.|||.|:|:.|.||.|:|..|.|||.|:|:
Zfish   148 IQGGLD--------NVSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKV 204

  Fly   238 WFQNRRAKDKR 248
            ||||||.|.||
Zfish   205 WFQNRRMKHKR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
hoxb2aNP_571191.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100 5/16 (31%)
Antp-type hexapeptide 103..108 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155 14/54 (26%)
Homeobox 162..214 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..338 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.