DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Gsx1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001178592.1 Gene:Gsx1 / 288457 RGDID:1310020 Length:261 Species:Rattus norvegicus


Alignment Length:300 Identity:82/300 - (27%)
Similarity:113/300 - (37%) Gaps:77/300 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PRQFFERLYGHLETRSSENGEIDVGTHAHKPPPCDTPY-----HSDGGSVSSPDISISDERTSLA 100
            ||.|   |...|..|.:.:.:...|:    |||. .||     |:..|  .||....:.:...|.
  Rat     2 PRSF---LVDSLVLREASDKKAPEGS----PPPL-FPYAVPPPHALHG--LSPGACHARKAGLLC 56

  Fly   101 AYP----AYDFYGH---------AKDYPQHPSQQ-HQQHHHHHHHPPQLVHQKLSYVSPPPAIAA 151
            ..|    |...:|.         ...:|...||. |......|...|.:.|.        ||.||
  Rat    57 VCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSVSPGVAHS--------PAAAA 113

  Fly   152 GGAANPVLPHAFPAGFPSDPH-FSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEY 215
            ..||  :...::|...|...| .|...|:      .:....:|.||.|::.|.|.||.||..|.|
  Rat   114 AAAA--LYQTSYPLPDPRQFHCISVDSSS------NQLPSSKRMRTAFTSTQLLELEREFASNMY 170

  Fly   216 ISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVANGFMSSIMGQAATTMP 280
            :||.||.|:|..|.|:|.|:||||||||.|.|:                .|..|:..|.|.    
  Rat   171 LSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKK----------------EGKGSNHRGGAG---- 215

  Fly   281 PGGVTGGVAVGVGLNYYAAA----------ATPAALPKDN 310
             .|..||...|...:..::|          .:|::..||:
  Rat   216 -AGAGGGAPQGCKCSSLSSAKCSEDDDELPMSPSSSGKDD 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
Gsx1NP_001178592.1 Homeobox 150..202 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.