DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxd4

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001099355.1 Gene:Hoxd4 / 288153 RGDID:1309690 Length:251 Species:Rattus norvegicus


Alignment Length:226 Identity:67/226 - (29%)
Similarity:89/226 - (39%) Gaps:73/226 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPPCD------------TPYHSDG--GSVSSPDISISDERTSLAAYPAYDF----YGHAKDYPQ 116
            |.|||:            ..|:..|  ||...|.          ..||..||    :|.....|.
  Rat    16 KFPPCEEYLQGGYLGEQGADYYGSGAQGSDFQPP----------GLYPRPDFGEQPFGGGGPGPG 70

  Fly   117 H--PSQQHQQH----HHHHHHPPQLVHQKLSYVSPPPAIAAGGAA--NPVLPHAFPAG------- 166
            .  |::.|.|.    ..|:..|.:      ...:||||...|..|  .|..|...|.|       
  Rat    71 SALPARGHGQEPSGPGSHYSAPGE------PCPAPPPAPLPGARACSQPTGPKQPPPGTALKQPA 129

  Fly   167 --FP---------SDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSR 220
              :|         .:|:::.             |..:|.||.::.:|.|.||.|||.|.|::|.|
  Rat   130 VVYPWMKKVHVNSVNPNYTG-------------GEPKRSRTAYTRQQVLELEKEFHFNRYLTRRR 181

  Fly   221 RFELAETLRLTETQIKIWFQNRRAKDKRIEK 251
            |.|:|.||.|:|.||||||||||.|.|:..|
  Rat   182 RIEIAHTLCLSERQIKIWFQNRRMKWKKDHK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
Hoxd4NP_001099355.1 Homeobox 155..209 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.