DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and ind

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:335 Identity:81/335 - (24%)
Similarity:105/335 - (31%) Gaps:154/335 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRHKVEIGSPDGSPGIKRSDSLDPIANTTILSVPQRPSSPRQFFERLYGHLETRSSENGEIDVG 65
            :.:.|.::|||.||          |.|...:.:....||.|...:...|              ||
  Fly    17 LSQKKEKLGSPGGS----------PTAAAAVAAAAMLPSIPMLPYPASY--------------VG 57

  Fly    66 THAHKPPPCDTPYHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQH-------- 122
            ::..                   .:.|..::..                 |...|||        
  Fly    58 SYLF-------------------SLGIQQQQQQ-----------------QQQQQQHAAAAAAAA 86

  Fly   123 ------QQHHHHHHHPPQLVH---------QKLS--------YVSPP----------PAI----- 149
                  |||.|....|..|.|         :|.|        |.|||          |.|     
  Fly    87 AAAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYG 151

  Fly   150 --AAGGAANPVLPHAFPAGFPSDPHFSAGFSAFL----------ARRRRKEG------------- 189
              ..||     ||...|..|.:.|  ||..||.|          .:|.:.|.             
  Fly   152 SPVVGG-----LPLPEPGSFCTSP--SASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHS 209

  Fly   190 ----------------RQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIW 238
                            ..:|.||.|::.|.|.||.||..|.|:||.||.|:|..|||:|.|:|||
  Fly   210 SGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIW 274

  Fly   239 FQNRRAKDKR 248
            |||||.|.|:
  Fly   275 FQNRRVKQKK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
indNP_996087.2 Homeobox 231..283 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439763
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.