DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and GBX2

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001476.2 Gene:GBX2 / 2637 HGNCID:4186 Length:348 Species:Homo sapiens


Alignment Length:165 Identity:49/165 - (29%)
Similarity:70/165 - (42%) Gaps:61/165 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIA 150
            |..|.|..|..|..||        |.::.|.|..::                      :||.:.|
Human   203 SDVDYSSDDNLTGQAA--------HKEEDPGHALEE----------------------TPPSSGA 237

  Fly   151 AGGAANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEY 215
            ||...:                               .|:.||:||.|::||.|.||.|||..:|
Human   238 AGSTTS-------------------------------TGKNRRRRTAFTSEQLLELEKEFHCKKY 271

  Fly   216 ISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIE 250
            :|.:.|.::|..|:|:|.|:||||||||||.||::
Human   272 LSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
GBX2NP_001476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 18/108 (17%)
Homeobox 250..303 CDD:306543 29/52 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.