Sequence 1: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001092304.1 | Gene: | GBX1 / 2636 | HGNCID: | 4185 | Length: | 363 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 58/197 - (29%) |
---|---|---|---|
Similarity: | 86/197 - (43%) | Gaps: | 46/197 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 KPPPCDTPYHSD-------GGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHH 127
Fly 128 HHHHPPQLVHQKLSYVSPPPAIAAGG-----AANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRK 187
Fly 188 EGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKA 252
Fly 253 QI 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ro | NP_524521.1 | Homeobox | 196..247 | CDD:278475 | 28/50 (56%) |
GBX1 | NP_001092304.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 128..265 | 26/136 (19%) | |||
Homeobox | 264..317 | CDD:306543 | 29/52 (56%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.770 |