DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and GBX1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001092304.1 Gene:GBX1 / 2636 HGNCID:4185 Length:363 Species:Homo sapiens


Alignment Length:197 Identity:58/197 - (29%)
Similarity:86/197 - (43%) Gaps:46/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPPCDTPYHSD-------GGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHH 127
            :|||...|:.|:       .|.|.|.|   .::..:.|..||             .|:|.::...
Human   162 EPPPPPPPHFSETFPSLPAEGKVYSSD---EEKLEASAGDPA-------------GSEQEEEGSG 210

  Fly   128 HHHHPPQLVHQKLSYVSPPPAIAAGG-----AANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRK 187
            ........:..           :|||     ...|.|..:...|.......:||.:|       .
Human   211 GDSEDDGFLDS-----------SAGGPGALLGPKPKLKGSLGTGAEEGAPVTAGVTA-------P 257

  Fly   188 EGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKA 252
            .|:.||:||.|::||.|.||.|||..:|:|.:.|.::|..|:|:|.|:||||||||||.|||:..
Human   258 GGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAG 322

  Fly   253 QI 254
            .:
Human   323 NV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
GBX1NP_001092304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..265 26/136 (19%)
Homeobox 264..317 CDD:306543 29/52 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.