DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Gbx1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001258382.1 Gene:Gbx1 / 246149 RGDID:621864 Length:425 Species:Rattus norvegicus


Alignment Length:248 Identity:65/248 - (26%)
Similarity:93/248 - (37%) Gaps:76/248 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GIKRSDSLDPIANTTILSVPQRPSSPRQFFERLYGHL----ETRSSENGEIDVGTHAHKPPPCDT 76
            |...:|.|.| |...:...|..|..|...|...:..|    :..||:..:::        ||...
  Rat   206 GALDADELLP-AREKVTEPPPPPPPPPPHFSETFPSLPAEGKVYSSDEEKLE--------PPAGE 261

  Fly    77 PYHS---DGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQ 138
            |..|   :.||....:.|..|   |.|..|.                                  
  Rat   262 PAGSEPEEEGSGGDSEDSFLD---SSAGGPG---------------------------------- 289

  Fly   139 KLSYVSPPPAI--AAGGAANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTE 201
              :.:.|.|.:  :.|..|....|.|.....|.                   |:.||:||.|::|
  Rat   290 --ALLGPKPKLKGSLGTGAEEGTPVATGVTTPG-------------------GKSRRRRTAFTSE 333

  Fly   202 QTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQI 254
            |.|.||.|||..:|:|.:.|.::|..|:|:|.|:||||||||||.|||:...:
  Rat   334 QLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNV 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
Gbx1NP_001258382.1 Homeobox 326..379 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.