DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and gbx2

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_694496.1 Gene:gbx2 / 245948 ZFINID:ZDB-GENE-020509-2 Length:342 Species:Danio rerio


Alignment Length:325 Identity:83/325 - (25%)
Similarity:112/325 - (34%) Gaps:128/325 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PIANTTILSV------PQRPSSPRQFFERLYG-HLETRSSENGEIDVGTHAHKPPPCDT------ 76
            |:.:||..|:      |.:| ||..|....|. .:..||       |......|||..|      
Zfish    15 PVGSTTAFSIDSLIGGPPQP-SPGHFVYTGYPMFMPYRS-------VVLPPPPPPPPPTLPQSAL 71

  Fly    77 ----PYHSDGGSVSSPDISISD----ERTSLAAYPAYDFYGHAKDYPQHPSQQHQ--------QH 125
                |:|...|..||...|::.    ..|.:|..|.        .:...||||||        |.
Zfish    72 PTTHPHHPIPGLPSSFCSSLAQGMALTSTLMATLPG--------GFSSSPSQQHQDAARKLGSQS 128

  Fly   126 HH---------------------------HHHHPPQLVH-------------------------- 137
            .|                           ...|..|.||                          
Zfish   129 IHAMFDKSQDIRLDGEDGKTFATKDSTSIPSFHDSQSVHTSTVRGHSKDDSKEDDCHRKDESFSM 193

  Fly   138 -QKLSYVS----PPPAI-------AAGGAANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRKEGR 190
             ..|.|.|    |..|:       .:||..:.|             |...|     |......|:
Zfish   194 DSDLDYSSDDNGPGNAMCQKEDGDGSGGLDDGV-------------HGGNG-----AGNTTSTGK 240

  Fly   191 QRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQID 255
            .||:||.|::||.|.||.|||..:|:|.:.|.::|..|:|:|.|:||||||||||.||::...::
Zfish   241 NRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNVN 305

  Fly   256  255
            Zfish   306  305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
gbx2NP_694496.1 Homeobox 244..297 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.