DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxb8

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001178578.1 Gene:Hoxb8 / 24457 RGDID:1586211 Length:243 Species:Rattus norvegicus


Alignment Length:216 Identity:66/216 - (30%)
Similarity:86/216 - (39%) Gaps:64/216 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRPSSPRQFFERLYGHLETRSSENGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDISISDERTSLA 100
            |.||..::|:             :|...:.|..::..||....|.|.|                 
  Rat    49 QHPSQIQEFY-------------HGPSSLSTAPYQQNPCAVACHGDPG----------------- 83

  Fly   101 AYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQ---KLSYVSPPPAIAAGGAANPVLPHA 162
                 :|||:  |..|..|....|       .|.||..   ||:..|.....|.|...:|.....
  Rat    84 -----NFYGY--DPLQRQSLFGAQ-------DPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQL 134

  Fly   163 FPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAET 227
            ||.   ..|..:||         |:.|||     |:|..|||.||.||..|.|::|.||.|::..
  Rat   135 FPW---MRPQAAAG---------RRRGRQ-----TYSRYQTLELEKEFLFNPYLTRKRRIEVSHA 182

  Fly   228 LRLTETQIKIWFQNRRAKDKR 248
            |.|||.|:||||||||.|.|:
  Rat   183 LGLTERQVKIWFQNRRMKWKK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
Hoxb8NP_001178578.1 Homeobox 150..203 CDD:395001 31/57 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.