DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Meox1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_036012267.1 Gene:Meox1 / 17285 MGIID:103220 Length:271 Species:Mus musculus


Alignment Length:201 Identity:45/201 - (22%)
Similarity:71/201 - (35%) Gaps:48/201 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LDPIANTTILSVPQRPSSPRQFFERLYGHLETRSSENGEIDVGTHAHKPPPCDTPYHSDG---GS 84
            :||:||:.:.: ||.|:.       ::|.|....||:......:|.   ||....:|...   .:
Mouse     1 MDPVANSCVRN-PQPPAP-------VWGCLRNPHSEDSSASGLSHY---PPTPFSFHQKSDFPAT 54

  Fly    85 VSSPDISIS-----------DERTSLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQ 138
            .:.||.|.|           .||.....:||         :||.|.         .|.|.....|
Mouse    55 AAYPDFSASCLAATPHSLPRTERIFNEQHPA---------FPQTPD---------WHFPISEAGQ 101

  Fly   139 KLSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQT 203
            :|: :.|..:....||.:|.|... .||...|   ............:|..|::::|:..|....
Mouse   102 RLN-LGPAGSAREMGAGSPGLVDG-TAGLGED---CMVLGTIANETEKKSSRRKKERSGQSLVPE 161

  Fly   204 LRLEVE 209
            ...|||
Mouse   162 PEDEVE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 4/14 (29%)
Meox1XP_036012267.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.