DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and ceh-12

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_491693.1 Gene:ceh-12 / 172255 WormBaseID:WBGene00000436 Length:180 Species:Caenorhabditis elegans


Alignment Length:204 Identity:66/204 - (32%)
Similarity:93/204 - (45%) Gaps:39/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FERLYGHLETRSSENGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDISISDERTSLAAYPAYDFYG 109
            |..:...|:..:|...| |....:|..||...|.:|         .|.|:|...:||..|     
 Worm     3 FSSIDSLLKISTSSQNE-DQKLESHPSPPSQIPNYS---------TSCSEELMKMAAKAA----- 52

  Fly   110 HAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHFS 174
                  |..:|...::.......|      .|.|:|..|..:  ...||||..:       .|.:
 Worm    53 ------QFAAQASLENSFSSSTSP------TSTVTPLSAYTS--LVQPVLPLIY-------DHLA 96

  Fly   175 AGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWF 239
            ..:|   ....:..|:.||.||.||:||.::||.:|..|.|:||.||::||:.|.|:||||||||
 Worm    97 LTYS---VNAWQAWGKMRRPRTAFSSEQLVQLEKQFSDNRYLSRPRRYQLAQQLSLSETQIKIWF 158

  Fly   240 QNRRAKDKR 248
            ||||.|:||
 Worm   159 QNRRMKNKR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 31/50 (62%)
ceh-12NP_491693.1 Homeobox 113..166 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.