DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxc4

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_038581.2 Gene:Hoxc4 / 15423 MGIID:96195 Length:264 Species:Mus musculus


Alignment Length:327 Identity:82/327 - (25%)
Similarity:111/327 - (33%) Gaps:132/327 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPPCD-------TPYHSDGGSVSSPDISISDERTSLAAYPAYDFYG----------HAKDYPQH 117
            |.|||:       .|.||.                        ::||          |.:.||..
Mouse    16 KFPPCEEYSQNSYIPEHSP------------------------EYYGRTRESGFQHHHQELYPPP 56

  Fly   118 P--------------------SQQHQQHHHHHHHPPQLVHQKLSYVSPP---PAIAAGGAANP-V 158
            |                    |:.|......||||.:         |.|   ||..:|.:|:| .
Mouse    57 PPRPSYPERQYSCTSLQGPGNSRAHGPAQAGHHHPEK---------SQPLCEPAPLSGTSASPSP 112

  Fly   159 LPHAFPAGFPSDPHFSAGFSAFLARRRRK-----------EGRQRRQRTTFSTEQTLRLEVEFHR 212
            .|.|.....|..|..:|.....:....:|           .|..:|.||.::.:|.|.||.|||.
Mouse   113 APPACSQPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHY 177

  Fly   213 NEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVANGFMSSIMGQAAT 277
            |.|::|.||.|:|.:|.|:|.||||||||||.|.|:      |....|..|.:.           
Mouse   178 NRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKK------DHRLPNTKVRSA----------- 225

  Fly   278 TMPPGGVTGGVAVGVGLNYYAAAATPAALPKDNTQDANFIDIDDQFQRQQQQKQQQQQQQQRRRE 342
              ||.|.....         .:||||.. .:|::|.|.                  ..:|||..:
Mouse   226 --PPAGAAPST---------LSAATPGT-SEDHSQSAT------------------PPEQQRAED 260

  Fly   343 TT 344
            .|
Mouse   261 IT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
Hoxc4NP_038581.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..130 28/143 (20%)
Antp-type hexapeptide 135..140 0/4 (0%)
Homeobox 159..213 CDD:365835 30/53 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..264 17/90 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.