DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxb5

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_032294.2 Gene:Hoxb5 / 15413 MGIID:96186 Length:269 Species:Mus musculus


Alignment Length:225 Identity:69/225 - (30%)
Similarity:89/225 - (39%) Gaps:55/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PQRPSSPRQFFERLYGHLETRSSE-----NGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDISISD 94
            |.....||  |.:........|.|     ||:    :|..||            |.|||    ||
Mouse    77 PASAQEPR--FRQATSSCSLSSPESLPCTNGD----SHGAKP------------SASSP----SD 119

  Fly    95 ERT---SLAAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAAN 156
            :.|   |.|.:...| ...|...|:..:.             ||....|:...|.|...:..|..
Mouse   120 QATPASSSANFTEID-EASASSEPEEAAS-------------QLSSPSLARAQPEPMATSTAAPE 170

  Fly   157 PVLPHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRR 221
            ...|..||  :....|.|...:.       .:|  :|.||.::..|||.||.|||.|.|::|.||
Mouse   171 GQTPQIFP--WMRKLHISHDMTG-------PDG--KRARTAYTRYQTLELEKEFHFNRYLTRRRR 224

  Fly   222 FELAETLRLTETQIKIWFQNRRAKDKRIEK 251
            .|:|..|.|:|.||||||||||.|.|:..|
Mouse   225 IEIAHALCLSERQIKIWFQNRRMKWKKDNK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
Hoxb5NP_032294.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..173 29/131 (22%)
Antp-type hexapeptide 176..181 2/6 (33%)
Homeobox 198..251 CDD:365835 31/52 (60%)
PRK07003 <67..>171 CDD:235906 29/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.