DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxb4

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus


Alignment Length:156 Identity:52/156 - (33%)
Similarity:71/156 - (45%) Gaps:36/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 SPPPAIAAGGAANPVLPHAF---PAGFP---------SDPHFSAGFSAFLARRRRKEGRQRRQRT 196
            ||||...|....:|...|:.   |..:|         .:|:::.             |..:|.||
Mouse   115 SPPPPPCAQNPLHPSPSHSACKEPVVYPWMRKVHVSTVNPNYAG-------------GEPKRSRT 166

  Fly   197 TFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNF 261
            .::.:|.|.||.|||.|.|::|.||.|:|..|.|:|.||||||||||.|.|:      |....|.
Mouse   167 AYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKK------DHKLPNT 225

  Fly   262 VVANGFMSSIMGQAATTMPPGGVTGG 287
            .:.:|..:...|.     |||...||
Mouse   226 KIRSGGTAGAAGG-----PPGRPNGG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133 6/17 (35%)
Antp-type hexapeptide 140..145 1/4 (25%)
Homeobox 164..218 CDD:395001 30/53 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.