DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxb1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_006532343.1 Gene:Hoxb1 / 15407 MGIID:96182 Length:330 Species:Mus musculus


Alignment Length:271 Identity:71/271 - (26%)
Similarity:96/271 - (35%) Gaps:98/271 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PPCDTP----YHSD---GGSVSSPDIS------ISDERTSLAA---YPAYDFYGHAKDYPQH-PS 119
            |||..|    |..:   ||.:.|..:.      :....:||..   .||...|..|...|.: ||
Mouse    29 PPCSAPAVDSYAGESRYGGGLPSSALQQNSGYPVQQPPSSLGVSFPSPAPSGYAPAACNPSYGPS 93

  Fly   120 QQH----QQHHHHHHHPPQLVHQKLSYVSP----PPAIAAGG-AANPVLPHAFPAGFPSDPHFSA 175
            |.:    .:....:.||.       ||.:.    |.:..||| .:.|..|...|.|......|::
Mouse    94 QYYSVGQSEGDGSYFHPS-------SYGAQLGGLPDSYGAGGVGSGPYPPPQPPYGTEQTATFAS 151

  Fly   176 GFSAF------------------------LARRRRKEGRQRRQ---------------------- 194
            .:...                        :.|...|.||.:|.                      
Mouse   152 AYDLLSEDKESPCSSEPSTLTPRTFDWMKVKRNPPKTGRAQRSHFLSLARAYTEGPEPGLHSFLQ 216

  Fly   195 -------------------RTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQ 240
                               ||.|:|.|...||.|||.|:|:||:||.|:|.||.|.|||:|||||
Mouse   217 LLLLAAKVSELGLGAPGGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQ 281

  Fly   241 NRRAKDKRIEK 251
            |||.|.|:.|:
Mouse   282 NRRMKQKKRER 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 32/50 (64%)
Hoxb1XP_006532343.1 Homeobox 236..289 CDD:365835 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45946
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.