DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxa9

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001264167.1 Gene:Hoxa9 / 15405 MGIID:96180 Length:295 Species:Mus musculus


Alignment Length:84 Identity:40/84 - (47%)
Similarity:51/84 - (60%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTE 232
            |.||:..|. :...||..||      :|..::..|||.||.||..|.|::|.||:|:|..|.|||
Mouse   213 PIDPNNPAA-NWLHARSTRK------KRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTE 270

  Fly   233 TQIKIWFQNRRAKDKRIEK 251
            .|:||||||||.|.|:|.|
Mouse   271 RQVKIWFQNRRMKMKKINK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
Hoxa9NP_001264167.1 Hox9_act <190..216 CDD:282473 1/2 (50%)
Homeobox 232..285 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.