Sequence 1: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034582.1 | Gene: | Hoxa3 / 15400 | MGIID: | 96175 | Length: | 443 | Species: | Mus musculus |
Alignment Length: | 267 | Identity: | 76/267 - (28%) |
---|---|---|---|
Similarity: | 97/267 - (36%) | Gaps: | 93/267 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 YHSDGGSVSSPDISISDERTSLAAYPAYDFYGHA--KDYPQHPSQQHQQHHHHHHHPPQLVHQKL 140
Fly 141 SYVSPPPAIAAGGAANPVLPHAF-PAGFPS--------DPHFSAGFSAFLARRRR---------- 186
Fly 187 -------KEGRQ---------------------------RRQRTTFSTEQTLRLEVEFHRNEYIS 217
Fly 218 RSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVANGFMSSIMGQ--AATTMP 280
Fly 281 PGGVTGG 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ro | NP_524521.1 | Homeobox | 196..247 | CDD:278475 | 29/50 (58%) |
Hoxa3 | NP_034582.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 74..151 | 22/90 (24%) | |
Antp-type hexapeptide | 156..161 | 0/4 (0%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 163..197 | 3/33 (9%) | |||
COG5576 | <182..309 | CDD:227863 | 42/109 (39%) | ||
Homeobox | 196..249 | CDD:365835 | 30/52 (58%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 248..354 | 11/43 (26%) | |||
DUF4074 | 378..441 | CDD:372548 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 401..443 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |