DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxa3

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_034582.1 Gene:Hoxa3 / 15400 MGIID:96175 Length:443 Species:Mus musculus


Alignment Length:267 Identity:76/267 - (28%)
Similarity:97/267 - (36%) Gaps:93/267 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YHSDGGSVSSPDISISDERTSLAAYPAYDFYGHA--KDYPQHPSQQHQQHHHHHHHPPQLVHQKL 140
            ||....|:.||        .|...:|.......|  :.....|||           ||.|....|
Mouse    46 YHRPACSLQSP--------ASAGGHPKTHELSEACLRTLSGPPSQ-----------PPGLGEPPL 91

  Fly   141 SYVSPPPAIAAGGAANPVLPHAF-PAGFPS--------DPHFSAGFSAFLARRRR---------- 186
               .|||..||..|..|..|... ||..|:        .|..||..:...|...:          
Mouse    92 ---PPPPPQAAPPAPQPPQPPPQPPAPTPAAPPPPSSVSPPQSANSNPTPASTAKSPLLNSPTVG 153

  Fly   187 -------KEGRQ---------------------------RRQRTTFSTEQTLRLEVEFHRNEYIS 217
                   ||.||                           :|.||.:::.|.:.||.|||.|.|:.
Mouse   154 KQIFPWMKESRQNTKQKTSGSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLC 218

  Fly   218 RSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVANGFMSSIMGQ--AATTMP 280
            |.||.|:|..|.|||.||||||||||.|.|:.:|.:            |.::|..||  :.:.:|
Mouse   219 RPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGK------------GMLTSSGGQSPSRSPVP 271

  Fly   281 PGGVTGG 287
            ||  .||
Mouse   272 PG--AGG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
Hoxa3NP_034582.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..151 22/90 (24%)
Antp-type hexapeptide 156..161 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..197 3/33 (9%)
COG5576 <182..309 CDD:227863 42/109 (39%)
Homeobox 196..249 CDD:365835 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..354 11/43 (26%)
DUF4074 378..441 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.