DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Mnx1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_064328.2 Gene:Mnx1 / 15285 MGIID:109160 Length:404 Species:Mus musculus


Alignment Length:305 Identity:88/305 - (28%)
Similarity:119/305 - (39%) Gaps:95/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ILSV-PQRPSSPRQFFERLYGHLETRSS---ENGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDIS 91
            :|:| |.|.:|.:.....|...|.|..|   ..|....||.:.....| :|..|:  :.::|...
Mouse    12 LLAVDPPRAASTQSAPLALVTSLATTVSGPGRGGSGGGGTSSGASRSC-SPASSE--ATAAPGDR 73

  Fly    92 ISDERTS----LAAY----PAYDFY-----GHAKDYPQHPSQQHQQHHHHHHHPPQLV------- 136
            :..|..|    |||:    |...|.     |.|...|..|        |||.||....       
Mouse    74 LRAESPSPPRLLAAHCALLPKPGFLGAGGGGGAAGGPGTP--------HHHAHPGAAAAAAAAAA 130

  Fly   137 ------------------------------HQKLSYVSPPPAIAAGGAANPVLPHAFP------A 165
                                          |...|| |...|.||....:|.|.:::|      .
Mouse   131 AAAAGGLALGLHPGGAQGGAGLPAQAALYGHPVYSY-SAAAAAAALAGQHPALSYSYPQVQGAHP 194

  Fly   166 GFPSDPHFSAGFSAF-LARRRRKE---------------------GRQRRQRTTFSTEQTLRLEV 208
            ..|:|| ...|.|.| |.:..|..                     |:.||.||.|:::|.|.||.
Mouse   195 AHPADP-IKLGASTFQLDQWLRASTAGMILPKMPDFSSQAQSNLLGKCRRPRTAFTSQQLLELEH 258

  Fly   209 EFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQ 253
            :|..|:|:||.:|||:|.:|.|||||:||||||||.|.||.:||:
Mouse   259 QFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
Mnx1NP_064328.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..80 10/46 (22%)
Homeobox 244..297 CDD:278475 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..404 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.