powered by:
Protein Alignment ro and Gbx2
DIOPT Version :9
Sequence 1: | NP_524521.1 |
Gene: | ro / 43234 |
FlyBaseID: | FBgn0003267 |
Length: | 350 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_034392.1 |
Gene: | Gbx2 / 14472 |
MGIID: | 95668 |
Length: | 348 |
Species: | Mus musculus |
Alignment Length: | 62 |
Identity: | 34/62 - (54%) |
Similarity: | 48/62 - (77%) |
Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 189 GRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIE 250
|:.||:||.|::||.|.||.|||..:|:|.:.|.::|..|:|:|.|:||||||||||.||::
Mouse 245 GKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVK 306
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
4 | 3.770 |
|
Return to query results.
Submit another query.