DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxb2

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_598793.2 Gene:Hoxb2 / 103889 MGIID:96183 Length:354 Species:Mus musculus


Alignment Length:281 Identity:74/281 - (26%)
Similarity:95/281 - (33%) Gaps:111/281 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FERLYGHLETRSS---------------ENGEIDVGTHAHKPPPCDTPYHS-------------- 80
            |||..|.:.::.|               :...|...|....|||.:..:.|              
Mouse     5 FEREIGFINSQPSLAECLTSFPAVLETFQTSSIKESTLIPPPPPLEQTFPSLQLGASTLQRPGSQ 69

  Fly    81 ----DGGSVSSPDISISDERTSLAAYPAYDF-YGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKL 140
                ||.::.||.       ....|.||.:| :...|...:.|||                    
Mouse    70 KQAGDGPALRSPP-------PLPVAPPAPEFPWMKEKKSTKKPSQ-------------------- 107

  Fly   141 SYVSPPPAIAAGGAANPVLPHAFPAGFPSD----PHFSAGFSAFLARRRRKEGRQRRQRTTFSTE 201
            |..||.||.::..|:.        .|.|||    |......|             ||.||.::..
Mouse   108 SAASPSPAASSVRASE--------VGSPSDGPGLPECGGSGS-------------RRLRTAYTNT 151

  Fly   202 QTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVANG 266
            |.|.||.|||.|:|:.|.||.|:|..|.|||.|:|:||||||.|.||                  
Mouse   152 QLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR------------------ 198

  Fly   267 FMSSIMGQAATTMPPGGVTGG 287
                   |.....||.|..||
Mouse   199 -------QTQHREPPEGEPGG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
Hoxb2NP_598793.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..143 29/151 (19%)
Antp-type hexapeptide 92..97 1/4 (25%)
Homeobox 145..197 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.