DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxa1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_037207.2 Gene:Hoxa1 / 103690132 RGDID:11414885 Length:334 Species:Rattus norvegicus


Alignment Length:240 Identity:76/240 - (31%)
Similarity:100/240 - (41%) Gaps:73/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PSSPRQFFERLYGHLETRSSENGEIDV-GTHAHKPPPCDTPYHSDGGSVSSPDISISDERTSLAA 101
            ||...|.|...||..    ..|.|.|| |.:    |||....:|  |::|||.:           
  Rat    96 PSYGAQNFSAPYGPY----GLNQEADVSGGY----PPCAPAVYS--GNLSSPMV----------- 139

  Fly   102 YPAYDFYGHAKDYPQHPSQQHQQHHHHHH-------HPPQLVHQKLSYVSPPPAIAAGGAANPVL 159
                                  ||||||.       ..||.:|.  ||.....::|.....|.:.
  Rat   140 ----------------------QHHHHHQGYAGGTVGSPQYIHH--SYGQEHQSLALATYNNSLS 180

  Fly   160 P-HA-------FPAGFPSDPHFSAGFSAFLARRRRKE----------GRQRRQRTTFSTEQTLRL 206
            | ||       .||...|.|  :..|.....:|...:          |:....||.|:|:|...|
  Rat   181 PLHASHQEACRSPASETSSP--AQTFDWMKVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQLTEL 243

  Fly   207 EVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEK 251
            |.|||.|:|::|:||.|:|.:|:|.|||:||||||||.|.|:.||
  Rat   244 EKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
Hoxa1NP_037207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..82
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 74..202 39/152 (26%)
COG5576 175..>285 CDD:227863 42/111 (38%)
Antp-type hexapeptide 203..208 1/4 (25%)
Homeobox 232..284 CDD:278475 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..334 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45946
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.