DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and mnx1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002935225.2 Gene:mnx1 / 100496534 XenbaseID:XB-GENE-919890 Length:338 Species:Xenopus tropicalis


Alignment Length:270 Identity:82/270 - (30%)
Similarity:103/270 - (38%) Gaps:93/270 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SPDGSPGIKRSDSL------------------------DPIANTTILSVPQRPSSPRQFFERLYG 50
            |..|||..:.:|||                        .|| |...|.....|..|.|   .|||
 Frog    37 SNSGSPPSEHTDSLRTDTPSPPRTCGLVPKPGFLSSHQHPI-NMMALHPQAAPGIPPQ---ALYG 97

  Fly    51 HLETRSSENGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYP 115
            |.....|....:..|.|                    |.:|          ||          ||
 Frog    98 HPMYSYSAAAALAAGQH--------------------PALS----------YP----------YP 122

  Fly   116 QHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAG--FPSDPHFSAGFS 178
            |      .|..||.|||..           |..|:||.........|..||  .|....|::...
 Frog   123 Q------MQGAHHAHHPVD-----------PIKISAGTFQLDQWLRASTAGMMLPKMADFNSQAQ 170

  Fly   179 AFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRR 243
            :.|.      |:.||.||.|:::|.|.||.:|..|:|:||.:|||:|.:|.|||||:||||||||
 Frog   171 SNLL------GKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRR 229

  Fly   244 AKDKRIEKAQ 253
            .|.||.:||:
 Frog   230 MKWKRSKKAK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 30/50 (60%)
mnx1XP_002935225.2 Homeobox 180..234 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.