DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and pdx1

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002934065.1 Gene:pdx1 / 100490648 XenbaseID:XB-GENE-483331 Length:271 Species:Xenopus tropicalis


Alignment Length:204 Identity:71/204 - (34%)
Similarity:85/204 - (41%) Gaps:53/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PPPC-------DTPYHS-----DGGSVSSPDIS------ISDERTSLAAYPAYDFYGHAKDYPQH 117
            ||.|       ...|.:     |.|  |.||||      ||:|                   |..
 Frog    32 PPACLYMGRQQQAAYSNPLVALDPG--SPPDISPYEVPPISEE-------------------PIV 75

  Fly   118 PSQQHQQHHHHHHHP--PQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHF----SAG 176
            |...|..||||||||  |. .||::.:.....:.........:||  ||....:..|.    ..|
 Frog    76 PHLHHHHHHHHHHHPGIPH-PHQQMPFPDDTESATLEERNRTLLP--FPWMKSTKSHTWKGQWTG 137

  Fly   177 FSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQN 241
            .|..:.:...|     |.||.::..|.|.||.||..|:||||.||.|||..|.|||..|||||||
 Frog   138 GSYIMEQEENK-----RTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQN 197

  Fly   242 RRAKDKRIE 250
            ||.|.|:.|
 Frog   198 RRMKWKKEE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 31/50 (62%)
pdx1XP_002934065.1 Homeobox 150..204 CDD:365835 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.