DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and Hoxb2

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002727852.1 Gene:Hoxb2 / 100361765 RGDID:2319509 Length:355 Species:Rattus norvegicus


Alignment Length:301 Identity:75/301 - (24%)
Similarity:97/301 - (32%) Gaps:107/301 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PGIKRSDSLDPIANTTILSVPQRPSSPRQFFERLYGHLETRSSENGEIDVGTHAHKPPPCDTPYH 79
            |.:..:.....|..:|:  :|..|....|.|..|.....|......:...|......||...|  
  Rat    26 PAVLETFQTSSIKESTL--IPPPPPPLEQTFPSLQLGASTLQRPGSQKPAGDGPALRPPPPLP-- 86

  Fly    80 SDGGSVSSPDISISDERTSLAAYPAYDF-YGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYV 143
                                .|.||.:| :...|...:.|||                    |..
  Rat    87 --------------------VAPPAPEFPWMKEKKSAKKPSQ--------------------SAA 111

  Fly   144 SPPPA---IAAGGAANPV----LPHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTE 201
            :|.||   :.|.|..:|.    ||.:..:|                        .||.||.::..
  Rat   112 TPSPAASSVRASGVGSPSDGPGLPESGGSG------------------------SRRLRTAYTNT 152

  Fly   202 QTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVANG 266
            |.|.||.|||.|:|:.|.||.|:|..|.|||.|:|:||||||.|.||                  
  Rat   153 QLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR------------------ 199

  Fly   267 FMSSIMGQAATTMPPGGVTGGVAVGVGLNYYAAAATPAALP 307
                   |.....||.|..|      ||:....|..||..|
  Rat   200 -------QTQHREPPDGEPG------GLSAQDDAGEPAEEP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
Hoxb2XP_002727852.1 Homeobox 146..198 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.