DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxc3

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:258 Identity:64/258 - (24%)
Similarity:99/258 - (38%) Gaps:98/258 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DVGTHAHKP--PPCDTPYHSDG-----------GSVSSPDISISDERTSLAAYPAYDFYGHAKDY 114
            :|...|.:|  |..|:|.....           |.||| |::..::::..:..|. ..:...|:.
 Frog    72 EVSEQAQQPKSPNSDSPLPKSASTQSCTSKKSTGPVSS-DVTSPNKKSKGSNMPK-QIFPWMKET 134

  Fly   115 PQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHFSAGFSA 179
            .|:..|:.|                    :||||..|     |.:.                 |:
 Frog   135 RQNSKQKKQ--------------------APPPADDA-----PAVD-----------------SS 157

  Fly   180 FLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRA 244
            ||:      ...:|.||.::..|.:.||.|||.|.|:.|.||.|:|:.|.|:|.||||||||||.
 Frog   158 FLS------SASKRARTAYTNSQLVELEKEFHFNRYLCRPRRLEMAKLLNLSERQIKIWFQNRRM 216

  Fly   245 KDKRIEKAQIDQHYRNFVVANGFMSSIMGQAATTMPPGGVTGGVAVGVGLNYYAAAATPAALP 307
            |.|:..|                     |:..     ||..||:         :.:::|:.:|
 Frog   217 KFKKDHK---------------------GKGG-----GGSPGGL---------SPSSSPSLMP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
hoxc3XP_002936696.1 Homeobox 167..220 CDD:395001 29/52 (56%)
DUF4074 335..392 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.