DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxa3

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001120901.1 Gene:hoxa3 / 100151729 XenbaseID:XB-GENE-482267 Length:406 Species:Xenopus tropicalis


Alignment Length:283 Identity:78/283 - (27%)
Similarity:105/283 - (37%) Gaps:88/283 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LYGHLETRSSENGEIDVGTHAHKPPP---CDTPYHSDGGSVSSP----------DISISDERTSL 99
            :||....:.: ||.....:....||.   .:|.||....|:.||          ||:.|..||  
 Frog    12 IYGGYPYQGA-NGFTYNASQQQYPPSSSLLETEYHRPACSLQSPGSAVPHHKANDINESCMRT-- 73

  Fly   100 AAYPAYDFYGHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSPPPAI--------AAGGAAN 156
                   ....:...|..|.||         ..||         .|||::        ||..::|
 Frog    74 -------INSQSNQAPVIPEQQ---------PTPQ---------GPPPSVSPPQTTSNAATASSN 113

  Fly   157 -------PVL-PHAFP-------------AGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFST 200
                   |.: ...||             ||..|.....||     .:....:...:|.||.:::
 Frog   114 KATSITSPTMSKQIFPWMKESRQNTKQQKAGSSSSGESCAG-----DKSPPGQSSSKRARTAYTS 173

  Fly   201 EQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVAN 265
            .|.:.||.|||.|.|:.|.||.|:|..|.|||.||||||||||.|.|:.:|.:            
 Frog   174 AQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGK------------ 226

  Fly   266 GFMSSIMGQAATTMP-PGGVTGG 287
            ..|:|..||:....| |....||
 Frog   227 SMMTSSGGQSPCRSPVPTPSVGG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 29/50 (58%)
hoxa3NP_001120901.1 Homeobox 168..221 CDD:395001 30/52 (58%)
DUF4074 344..404 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.