DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ro and hoxa2

DIOPT Version :9

Sequence 1:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_004915456.1 Gene:hoxa2 / 100038099 XenbaseID:XB-GENE-488087 Length:373 Species:Xenopus tropicalis


Alignment Length:228 Identity:67/228 - (29%)
Similarity:97/228 - (42%) Gaps:41/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FERLYGHLETRSSENGEIDVGTHAHKPPPCDTPYHSDGGSVSSPDISISD------ERTSLAAYP 103
            |||..|.:      |.:..:.......||....:.|  .|:.|..:|.|.      |:|..:..|
 Frog     5 FEREIGFI------NSQPSLAECLTSFPPVGDTFQS--SSIKSSALSHSTLIPPPFEQTIPSLNP 61

  Fly   104 AYDFYGHAKDYPQHPSQQHQQHHHHHHH------PPQ---LVHQKLSYVSPPPAIAAGGAANPVL 159
            .        .:|:|...:|..:.|....      ||:   :..:|.|..:|..|..|..||:   
 Frog    62 G--------SHPRHSRPKHSPNGHGDSPVPAGSLPPEYPWMKEKKASKKAPIAAATAAAAAS--- 115

  Fly   160 PHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFEL 224
              |.||......|     ...:..:....|..||.||.::..|.|.||.|||.|:|:.|.||.|:
 Frog   116 --AAPATTACLSH-----KEIIEIQDNSSGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEI 173

  Fly   225 AETLRLTETQIKIWFQNRRAKDKRIEKAQIDQH 257
            |..|.|||.|:|:||||||.|.||..:.:.:|:
 Frog   174 AALLDLTERQVKVWFQNRRMKHKRQTQCKENQN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
hoxa2XP_004915456.1 Homeobox 144..197 CDD:365835 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.