DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5500 and C49A9.10

DIOPT Version :9

Sequence 1:NP_651511.1 Gene:CG5500 / 43233 FlyBaseID:FBgn0039461 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001023083.1 Gene:C49A9.10 / 3565073 WormBaseID:WBGene00016764 Length:113 Species:Caenorhabditis elegans


Alignment Length:90 Identity:31/90 - (34%)
Similarity:47/90 - (52%) Gaps:7/90 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NIEIP--PEPTTCCMSGCANCVWLDYAQTL-----AKLLGDNDEEAREIVLSKITDPNLKMFLSL 136
            |:..|  |||..||..||.:||||.|||.|     :|...:..|..:|.:..||..|::|.::.:
 Worm    24 NMRPPMEPEPGLCCQEGCESCVWLIYAQELLDYYRSKYPTNTLERVKEEIGDKIESPSVKEYVLM 88

  Fly   137 ELRQMAKQREEKAAAEKAAKQGKPK 161
            |:....|:.::.||.....|.|:.|
 Worm    89 EISMSEKRYKDMAALGTRKKPGESK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5500NP_651511.1 Oxidored-like <83..>103 CDD:286830 12/21 (57%)
C49A9.10NP_001023083.1 Oxidored-like 27..>56 CDD:370696 16/28 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1552217at2759
OrthoFinder 1 1.000 - - FOG0005892
OrthoInspector 1 1.000 - - oto20080
orthoMCL 1 0.900 - - OOG6_108985
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5344
SonicParanoid 1 1.000 - - X4278
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.740

Return to query results.
Submit another query.