DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5500 and OXLD1

DIOPT Version :9

Sequence 1:NP_651511.1 Gene:CG5500 / 43233 FlyBaseID:FBgn0039461 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001034931.1 Gene:OXLD1 / 339229 HGNCID:27901 Length:147 Species:Homo sapiens


Alignment Length:141 Identity:46/141 - (32%)
Similarity:63/141 - (44%) Gaps:15/141 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLRRGAERWASLARQLSGSSSQDDASSKDAAAQEAASG-----------CPPNSTTTGTDTPKA 66
            :||||..|...::|..:.||.:: ..||.|...:....|           .|......|||..:.
Human     1 MLLRRVVEGGRAVAAAVRGSGAR-RFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEV 64

  Fly    67 KDKTTKGRKRLRNIEIPPE---PTTCCMSGCANCVWLDYAQTLAKLLGDNDEEAREIVLSKITDP 128
            ..:......|.....:|||   ||.||||||.||||::||..|.:...|..|.|...:...:.|.
Human    65 GSQAGADGTRPPKASLPPELQPPTNCCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADE 129

  Fly   129 NLKMFLSLELR 139
            |||.||.:|:|
Human   130 NLKAFLRMEIR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5500NP_651511.1 Oxidored-like <83..>103 CDD:286830 15/22 (68%)
OXLD1NP_001034931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..82 6/45 (13%)
Oxidored-like 79..>107 CDD:313082 17/27 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156574
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E1DE
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5320
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1552217at2759
OrthoFinder 1 1.000 - - FOG0005892
OrthoInspector 1 1.000 - - oto91831
orthoMCL 1 0.900 - - OOG6_108985
Panther 1 1.100 - - LDO PTHR21193
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5344
SonicParanoid 1 1.000 - - X4278
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.