DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5500 and oxld1

DIOPT Version :9

Sequence 1:NP_651511.1 Gene:CG5500 / 43233 FlyBaseID:FBgn0039461 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_001335873.1 Gene:oxld1 / 100001148 ZFINID:ZDB-GENE-130603-23 Length:131 Species:Danio rerio


Alignment Length:114 Identity:37/114 - (32%)
Similarity:57/114 - (50%) Gaps:21/114 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SSSQDDASSKDAAAQEAASGCP--PNSTTTGTDTPKAKDKTTKGRKRLRNIEIPPEPTTCCMSGC 94
            ::.:...||.|:::..::...|  | |:.||.:.|                  |..||.||||||
Zfish    36 TACEQQCSSPDSSSSVSSVKKPLIP-SSETGDEGP------------------PSAPTHCCMSGC 81

  Fly    95 ANCVWLDYAQTLAKLLGDNDEEAREIVLSKITDPNLKMFLSLELRQMAK 143
            .||||::||:.|.|...|..|.|.|.:...:.|.|||.:|.:|::.:.|
Zfish    82 HNCVWIEYAEKLLKYYSDGGERALEAIEKNVLDDNLKAYLKMEIKLLKK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5500NP_651511.1 Oxidored-like <83..>103 CDD:286830 13/19 (68%)
oxld1XP_001335873.1 Oxidored-like 69..>93 CDD:286830 16/41 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1552217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5344
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.