DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and AT1G01080

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001030925.1 Gene:AT1G01080 / 839463 AraportID:AT1G01080 Length:294 Species:Arabidopsis thaliana


Alignment Length:204 Identity:53/204 - (25%)
Similarity:89/204 - (43%) Gaps:36/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSDESADVIVLADRE---EDDICELEHLRK-----LFIGGL-APYTTEENLKLFYGQWGKVVDV- 61
            |.:|..:.:|..:.|   :..:.:.|.::|     |::..: ..|...:.|.:|. .:|.|:.| 
plant    75 LDEEKEEEVVKGEAEPNKDSVVSKAEPVKKPRPCELYVCNIPRSYDIAQLLDMFQ-PFGTVISVE 138

  Fly    62 VVMRDAATKRSRGFGFITY--TKSLMVDRAQENRPHIIDGKTVEAKRAL--------PRPERESR 116
            ||.|:..|..|||.|::|.  ..|..:..|.      :||..|..:...        |...|...
plant   139 VVSRNPQTGESRGSGYVTMGSINSAKIAIAS------LDGTEVGGREMRVRYSVDMNPGTRRNPE 197

  Fly   117 ETNISVKKL---------FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFD 172
            ..|.:.||:         :||.|......:.||.:|.:||.:||.::|.|:.||:.|.|||:.|.
plant   198 VLNSTPKKILMYESQHKVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFT 262

  Fly   173 DYDAVDKAI 181
            ..:..|.|:
plant   263 SGEERDAAL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 22/93 (24%)
RRM2_hnRNPA_like 124..196 CDD:240774 22/67 (33%)
AT1G01080NP_001030925.1 RRM_SF 110..183 CDD:302621 21/79 (27%)
RRM 214..285 CDD:214636 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.