DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and CP31B

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_199836.1 Gene:CP31B / 835090 AraportID:AT5G50250 Length:289 Species:Arabidopsis thaliana


Alignment Length:184 Identity:57/184 - (30%)
Similarity:96/184 - (52%) Gaps:19/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DEPLSDESADVIVLADREEDDICELEHLRKLFIGGLAPYTTE-ENLKLFYGQWG--KVVDVVVMR 65
            ||  |.||.|.:...:..|:        .|||:|.| ||..: :.|.:.:.|.|  ::.:|:..|
plant    95 DE--SFESEDGVGFPEPPEE--------AKLFVGNL-PYDVDSQALAMLFEQAGTVEISEVIYNR 148

  Fly    66 DAATKRSRGFGFITYTKSLMVDRAQEN-RPHIIDGKTVEAKRALPRPERESRETNI--SVKKLFV 127
            |  |.:||||||:|.:.....::|.|. ....::|:.:...||.||..|..|:..:  :..:::|
plant   149 D--TDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPRGSRPERQPRVYDAAFRIYV 211

  Fly   128 GGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAI 181
            |.|..:.|...|...|.:.|.||..::::|:.||:.|||.||:..:.:.|:.||
plant   212 GNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 26/80 (33%)
RRM2_hnRNPA_like 124..196 CDD:240774 20/58 (34%)
CP31BNP_199836.1 RRM_SF 114..193 CDD:418427 27/81 (33%)
RRM2_NsCP33_like 208..283 CDD:410187 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.