DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Hnrnpab

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_006246407.1 Gene:Hnrnpab / 83498 RGDID:69255 Length:332 Species:Rattus norvegicus


Alignment Length:276 Identity:86/276 - (31%)
Similarity:134/276 - (48%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DVIVLADREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGF 77
            |.|..:..|||       ..|:|:|||:..|::::||.::.::|:|||..:..|..|.|||||||
  Rat    63 DQINASKNEED-------AGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGF 120

  Fly    78 ITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREY 142
            |.:..|..|::..:.:.|.:||:.::.|:|:...:.       .|||:|||||.....||.:|||
  Rat   121 ILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKD-------PVKKIFVGGLNPEATEEKIREY 178

  Fly   143 FLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVK----KSIYNLD 203
            |.|||.:.:::|..|....|||||.|:.|.:.|.|.|.:.||.|.:.....::|    |.:|   
  Rat   179 FGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVY--- 240

  Fly   204 KKEKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPPVPPQQAMGP----YQQQPPPA 264
            ::::...||..|.     |:..:..||||...........:......||..||    |...|   
  Rat   241 QQQQYGSGGRGNR-----NRGNRGSGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSP--- 297

  Fly   265 PMSAPPPNFNYWGPPP 280
                    :.|:|..|
  Rat   298 --------YGYYGYGP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 29/76 (38%)
RRM2_hnRNPA_like 124..196 CDD:240774 30/71 (42%)
HnrnpabXP_006246407.1 CBFNT 1..75 CDD:311868 5/18 (28%)
RRM1_hnRNPAB 71..150 CDD:410151 31/85 (36%)
RRM2_hnRNPAB 155..234 CDD:409997 33/85 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.