DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and AT5G46840

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_199496.1 Gene:AT5G46840 / 834728 AraportID:AT5G46840 Length:501 Species:Arabidopsis thaliana


Alignment Length:186 Identity:37/186 - (19%)
Similarity:62/186 - (33%) Gaps:61/186 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FSAANSSFETENYEMRIKIKWGRGIETFVHRRYQKFEDIFNQLAAKESADRACIFLNLDDRIVYA 179
            :|...|.|..:.|   :|..|    ||..|..:...:.:.|...|....|  .::...::|:   
plant   257 YSIHPSRFPDDPY---MKSFW----ETVFHCIWPGNDAVNNTSPALLKED--IVWCTGEERL--- 309

  Fly   180 SDTPDSID---YKPHQFIAGRILKTKAPILPTAH----------GSSTGHNSNMITLKVQMEKRK 231
                ||||   |..:.||..  .:|...:...||          |.....|.:...:     ...
plant   310 ----DSIDPNIYDVYNFIYS--YRTHNAVFAVAHALHQMKNCVPGKGPFKNGSCADI-----YNH 363

  Fly   232 QPLRL-----QIDKNQTMSVLVIKCAEELKCEPKDIRLYFDGELVGNNDKPEDLDL 282
            :|.:|     ::|.|.|...                |:|||    .|.|.|:.:::
plant   364 RPWQLLHYLRKVDFNNTAGK----------------RIYFD----ENGDVPQSVEI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 17/74 (23%)
RRM_SF 33..110 CDD:473069
AT5G46840NP_199496.1 RRM1_RBM34 171..261 CDD:409828 1/3 (33%)
RRM2_RBM34 284..360 CDD:409829 16/86 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.