DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and RBP31

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001328008.1 Gene:RBP31 / 828579 AraportID:AT4G24770 Length:329 Species:Arabidopsis thaliana


Alignment Length:196 Identity:59/196 - (30%)
Similarity:92/196 - (46%) Gaps:22/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DEPLSDESADVIVLADREEDDIC-----------ELEHLRKLFIGGLAPYTTEENLKLFYGQWGK 57
            ||...|.|...:...|..|.|:.           |.....|||:|.||.....:.|.:.:.|.|.
plant   111 DESEGDASEGDVSEGDESEGDVSEGAVSERAEFPEPSEEAKLFVGNLAYDVNSQALAMLFEQAGT 175

  Fly    58 VVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQE-----NRPHIIDGKTVEAKRALPRPERESRE 117
            |....|:.:..|.:||||||:|.:.   ||.|:.     || :.::|:.:...:|.||..|..|.
plant   176 VEIAEVIYNRETDQSRGFGFVTMSS---VDEAETAVEKFNR-YDLNGRLLTVNKAAPRGSRPERA 236

  Fly   118 TNI--SVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKA 180
            ..:  ...:::||.|..:.|...|.:.|.:.|.||..:::.|:.||:.|||.||...|.|.:::|
plant   237 PRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEA 301

  Fly   181 I 181
            |
plant   302 I 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 26/81 (32%)
RRM2_hnRNPA_like 124..196 CDD:240774 21/58 (36%)
RBP31NP_001328008.1 RRM_HP0827_like 151..228 CDD:240845 26/80 (33%)
RRM_HP0827_like 245..321 CDD:240845 21/58 (36%)
DNA_pol_phi <87..145 CDD:368199 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.