DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and GR-RBP2

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_193121.1 Gene:GR-RBP2 / 827019 AraportID:AT4G13850 Length:158 Species:Arabidopsis thaliana


Alignment Length:58 Identity:28/58 - (48%)
Similarity:37/58 - (63%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAI 181
            |||:|||....|:..||:.|..||:||..|::.|:.||:.|||.||.|:|..|...||
plant    36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAI 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 28/58 (48%)
RRM_SF 33..110 CDD:473069
GR-RBP2NP_193121.1 PLN03134 1..143 CDD:178680 28/58 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.