DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and PHIP1

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_191094.1 Gene:PHIP1 / 824700 AraportID:AT3G55340 Length:597 Species:Arabidopsis thaliana


Alignment Length:183 Identity:48/183 - (26%)
Similarity:88/183 - (48%) Gaps:21/183 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDV-VVMR--DAATKRSRGFGFITY 80
            ::|||.:..    .||::||:...:||:.::.::...|.::.| ..||  |.|..   |..|||:
plant   152 NKEEDGVVP----NKLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKMRPEDGAFS---GIAFITF 209

  Fly    81 ------TKSLMVDRAQENRPHIIDGKTVEAKR-ALPRPERES---RETNISVKKLFVGGLKDNHD 135
                  .::|..|||.....::...:.|:... ::||.:..|   .|......::::|.|..:..
plant   210 DTEDGAKRALAFDRAAMGDRYLTIQQYVKTTTPSIPRRKTSSGFAPEMVDGYNRVYIGNLAWDTT 274

  Fly   136 EECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAI 188
            |..:|:.|... .:.||:|..:|.||:.:|:|.|:|.|..:|..|:...|..|
plant   275 ERDIRKLFSDC-VINSVRLGKNKETGEFKGYAHVDFKDSVSVAIALKLDQQVI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 21/86 (24%)
RRM2_hnRNPA_like 124..196 CDD:240774 20/65 (31%)
PHIP1NP_191094.1 RRM <129..327 CDD:223796 48/183 (26%)
RRM1_PHIP1 163..234 CDD:240717 19/73 (26%)
RRM2_PHIP1 263..334 CDD:240718 20/65 (31%)
PTZ00368 393..592 CDD:173561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.