Sequence 1: | NP_001014671.1 | Gene: | Rb97D / 43231 | FlyBaseID: | FBgn0004903 | Length: | 471 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001190079.1 | Gene: | CP29 / 824514 | AraportID: | AT3G53460 | Length: | 363 | Species: | Arabidopsis thaliana |
Alignment Length: | 237 | Identity: | 50/237 - (21%) |
---|---|---|---|
Similarity: | 77/237 - (32%) | Gaps: | 88/237 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVD-RAQENRPHI 96
Fly 97 ---------------------IDGKTVEAKRALPRPERE-------------------------- 114
Fly 115 ----------------------------------------SRETNISVKKLFVGGLKDNHDEECL 139
Fly 140 REYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAI 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rb97D | NP_001014671.1 | RRM1_hnRNPA_like | 33..110 | CDD:241022 | 24/98 (24%) |
RRM2_hnRNPA_like | 124..196 | CDD:240774 | 20/58 (34%) | ||
CP29 | NP_001190079.1 | RRM_SF | 100..194 | CDD:302621 | 24/93 (26%) |
RRM_HP0827_like | 279..355 | CDD:240845 | 20/58 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1202220at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |