DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and CP29

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001190079.1 Gene:CP29 / 824514 AraportID:AT3G53460 Length:363 Species:Arabidopsis thaliana


Alignment Length:237 Identity:50/237 - (21%)
Similarity:77/237 - (32%) Gaps:88/237 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVD-RAQENRPHI 96
            |||:|.|:.......|...:...|.|..|.|:.|..|.|||||||:|.:.:..|: .||:...::
plant   100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYV 164

  Fly    97 ---------------------IDGKTVEAKRALPRPERE-------------------------- 114
                                 .:|:.:......|.|:||                          
plant   165 SRYLCSLLCLYLLIRVLCGLEFEGRPLRVNAGPPPPKREESFSRGPRSGGYGSERGGGYGSERGG 229

  Fly   115 ----------------------------------------SRETNISVKKLFVGGLKDNHDEECL 139
                                                    |...:.|..:|:||.|....|:..|
plant   230 GYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMAL 294

  Fly   140 REYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAI 181
            ...|.:.|.||..:::.|:.:|:.:||.||.......|.|||
plant   295 ENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 24/98 (24%)
RRM2_hnRNPA_like 124..196 CDD:240774 20/58 (34%)
CP29NP_001190079.1 RRM_SF 100..194 CDD:302621 24/93 (26%)
RRM_HP0827_like 279..355 CDD:240845 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.